MCM6 antibody (70R-1614)

Rabbit polyclonal MCM6 antibody raised against the C terminal of MCM6

Synonyms Polyclonal MCM6 antibody, Anti-MCM6 antibody, MCM-6 antibody, MCM 6, MCM 6 antibody, MCM6, Minichromosome Maintenance Complex Component 6 antibody, MCM-6
Specificity MCM6 antibody was raised against the C terminal of MCM6
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen MCM6 antibody was raised using the C terminal of MCM6 corresponding to a region with amino acids RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE
Assay Information MCM6 Blocking Peptide, catalog no. 33R-7967, is also available for use as a blocking control in assays to test for specificity of this MCM6 antibody


Immunohistochemical staining using MCM6 antibody (70R-1614)

MCM6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (lndicated with Arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MCM6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by the MCM6 gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using MCM6 antibody (70R-1614) | MCM6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (lndicated with Arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using MCM6 antibody (70R-1614) | MCM6 antibody (70R-1614) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors