MCM7 antibody (70R-1621)

Rabbit polyclonal MCM7 antibody raised against the middle region of MCM7

Synonyms Polyclonal MCM7 antibody, Anti-MCM7 antibody, MCM7, MCM-7, Minichromosome Maintenance Complex Component 7 antibody, MCM 7 antibody, MCM-7 antibody, MCM 7
Specificity MCM7 antibody was raised against the middle region of MCM7
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen MCM7 antibody was raised using the middle region of MCM7 corresponding to a region with amino acids GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV
Assay Information MCM7 Blocking Peptide, catalog no. 33R-3298, is also available for use as a blocking control in assays to test for specificity of this MCM7 antibody

Images

Western Blot analysis using MCM7 antibody (70R-1621)

MCM7 antibody (70R-1621) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MCM7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MCM7 antibody (70R-1621) | MCM7 antibody (70R-1621) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors