MCM8 antibody (70R-5551)

Rabbit polyclonal MCM8 antibody raised against the N terminal of MCM8

Synonyms Polyclonal MCM8 antibody, Anti-MCM8 antibody, Minichromosome Maintenance Complex Component 8 antibody, MGC119522 antibody, MCM8, MGC4816 antibody, REC antibody, MCM 8, MCM-8, MCM-8 antibody, dJ967N21.5 antibody, MGC119523 antibody, C20orf154 antibody, MGC12866 antibody, MCM 8 antibody
Specificity MCM8 antibody was raised against the N terminal of MCM8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MCM8 antibody was raised using the N terminal of MCM8 corresponding to a region with amino acids ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH
Assay Information MCM8 Blocking Peptide, catalog no. 33R-2568, is also available for use as a blocking control in assays to test for specificity of this MCM8 antibody

Images

Western Blot analysis using MCM8 antibody (70R-5551)

MCM8 antibody (70R-5551) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MCM8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MCM8 antibody (70R-5551) | MCM8 antibody (70R-5551) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors