MCM8 antibody (70R-5605)

Rabbit polyclonal MCM8 antibody raised against the N terminal of MCM8

Synonyms Polyclonal MCM8 antibody, Anti-MCM8 antibody, MCM-8, MGC4816 antibody, Minichromosome Maintenance Complex Component 8 antibody, MCM 8, MCM 8 antibody, MGC12866 antibody, dJ967N21.5 antibody, MCM-8 antibody, REC antibody, C20orf154 antibody, MGC119522 antibody, MCM8, MGC119523 antibody
Specificity MCM8 antibody was raised against the N terminal of MCM8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MCM8 antibody was raised using the N terminal of MCM8 corresponding to a region with amino acids RFIPYKGWKLYFSEVYSDSSPLIEKIQAFEKFFTRHIDLYDKDEIERKGS
Assay Information MCM8 Blocking Peptide, catalog no. 33R-7902, is also available for use as a blocking control in assays to test for specificity of this MCM8 antibody


Western Blot analysis using MCM8 antibody (70R-5605)

MCM8 antibody (70R-5605) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MCM8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MCM8 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MCM8 antibody (70R-5605) | MCM8 antibody (70R-5605) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors