MDH1 antibody (70R-1116)

Rabbit polyclonal MDH1 antibody

Synonyms Polyclonal MDH1 antibody, Anti-MDH1 antibody, Malate Dehydrogenase 1 Nad antibody, MDH 1, MOR2 antibody, MGC:1375 antibody, MDH-s antibody, MDH1, MDHA antibody, MDH-1, MDH 1 antibody, MDH-1 antibody
Cross Reactivity Human, Mouse, Rat, Arabidopsis
Applications WB
Immunogen MDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV
Assay Information MDH1 Blocking Peptide, catalog no. 33R-6690, is also available for use as a blocking control in assays to test for specificity of this MDH1 antibody


Western Blot analysis using MDH1 antibody (70R-1116)

MDH1 antibody (70R-1116) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MDH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MDH1 antibody (70R-1116) | MDH1 antibody (70R-1116) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors