MFAP1 antibody (70R-4332)

Rabbit polyclonal MFAP1 antibody raised against the middle region of MFAP1

Synonyms Polyclonal MFAP1 antibody, Anti-MFAP1 antibody, MFAP 1 antibody, MFAP1, MFAP-1 antibody, MFAP-1, Microfibrillar-Associated Protein 1 antibody, MFAP 1
Specificity MFAP1 antibody was raised against the middle region of MFAP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MFAP1 antibody was raised using the middle region of MFAP1 corresponding to a region with amino acids TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT
Assay Information MFAP1 Blocking Peptide, catalog no. 33R-9156, is also available for use as a blocking control in assays to test for specificity of this MFAP1 antibody

Images

Western Blot analysis using MFAP1 antibody (70R-4332)

MFAP1 antibody (70R-4332) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MFAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MFAP1 is a component of the elastin-associated microfibrils.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MFAP1 antibody (70R-4332) | MFAP1 antibody (70R-4332) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors