MFAP2 antibody (70R-5452)

Rabbit polyclonal MFAP2 antibody raised against the N terminal of MFAP2

Synonyms Polyclonal MFAP2 antibody, Anti-MFAP2 antibody, MAGP antibody, MAGP-1 antibody, MAGP1 antibody, MFAP 2, MFAP-2, MFAP 2 antibody, Microfibrillar-Associated Protein 2 antibody, MFAP-2 antibody, MFAP2
Specificity MFAP2 antibody was raised against the N terminal of MFAP2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MFAP2 antibody was raised using the N terminal of MFAP2 corresponding to a region with amino acids MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY
Assay Information MFAP2 Blocking Peptide, catalog no. 33R-6351, is also available for use as a blocking control in assays to test for specificity of this MFAP2 antibody

Images

Western Blot analysis using MFAP2 antibody (70R-5452)

MFAP2 antibody (70R-5452) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MFAP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MFAP2 antibody (70R-5452) | MFAP2 antibody (70R-5452) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors