MGAT2 antibody (70R-1857)

Rabbit polyclonal MGAT2 antibody

Synonyms Polyclonal MGAT2 antibody, Anti-MGAT2 antibody, MGAT-2, MGAT-2 antibody, GLCNACTII antibody, CDGS2 antibody, Mannosyl antibody, MGAT2, MGAT 2, GNT-II antibody, MGAT 2 antibody, GNT2 antibody, Alpha 1-6-Glycoprotein Beta-1-2-N-Acetylglucosaminyltransferase antibody
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen MGAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRD
Assay Information MGAT2 Blocking Peptide, catalog no. 33R-7174, is also available for use as a blocking control in assays to test for specificity of this MGAT2 antibody

Images

Immunohistochemical staining using MGAT2 antibody (70R-1857)

MGAT2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MGAT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using MGAT2 antibody (70R-1857) | MGAT2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using MGAT2 antibody (70R-1857) | MGAT2 antibody (70R-1857) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors