MGC27016 antibody (70R-4976)

Rabbit polyclonal MGC27016 antibody raised against the N terminal of MGC27016

Synonyms Polyclonal MGC27016 antibody, Anti-MGC27016 antibody, MGC27016, MGC 27016 antibody, MGC-27016, Hypothetical Protein Mgc27016 antibody, MGC 27016, MGC-27016 antibody
Specificity MGC27016 antibody was raised against the N terminal of MGC27016
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen MGC27016 antibody was raised using the N terminal of MGC27016 corresponding to a region with amino acids LNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVD
Assay Information MGC27016 Blocking Peptide, catalog no. 33R-5233, is also available for use as a blocking control in assays to test for specificity of this MGC27016 antibody

Images

Immunohistochemical staining using MGC27016 antibody (70R-4976)

MGC27016 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC27016 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MGC27016 is involved in pseudouridine synthase activity and RNA binding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using MGC27016 antibody (70R-4976) | MGC27016 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using MGC27016 antibody (70R-4976) | MGC27016 antibody (70R-4976) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors