MGC48628 antibody (70R-3620)

Rabbit polyclonal MGC48628 antibody raised against the N terminal of MGC48628

Synonyms Polyclonal MGC48628 antibody, Anti-MGC48628 antibody, Similar To Kiaa1680 Protein antibody, MGC 48628 antibody, MGC48628, MGC 48628, MGC-48628 antibody, MGC-48628
Specificity MGC48628 antibody was raised against the N terminal of MGC48628
Cross Reactivity Human
Applications WB
Immunogen MGC48628 antibody was raised using the N terminal of MGC48628 corresponding to a region with amino acids HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS
Assay Information MGC48628 Blocking Peptide, catalog no. 33R-3746, is also available for use as a blocking control in assays to test for specificity of this MGC48628 antibody


Western Blot analysis using MGC48628 antibody (70R-3620)

MGC48628 antibody (70R-3620) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC48628 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC48628 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MGC48628 antibody (70R-3620) | MGC48628 antibody (70R-3620) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors