MGC50273 antibody (70R-4290)

Rabbit polyclonal MGC50273 antibody raised against the N terminal of MGC50273

Synonyms Polyclonal MGC50273 antibody, Anti-MGC50273 antibody, MGC-50273, MGC-50273 antibody, Mgc50273 Protein antibody, MGC50273, MGC 50273 antibody, MGC 50273
Specificity MGC50273 antibody was raised against the N terminal of MGC50273
Cross Reactivity Human
Applications WB
Immunogen MGC50273 antibody was raised using the N terminal of MGC50273 corresponding to a region with amino acids MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE
Assay Information MGC50273 Blocking Peptide, catalog no. 33R-6007, is also available for use as a blocking control in assays to test for specificity of this MGC50273 antibody

Images

Western Blot analysis using MGC50273 antibody (70R-4290)

MGC50273 antibody (70R-4290) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC50273 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC50273 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MGC50273 antibody (70R-4290) | MGC50273 antibody (70R-4290) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors