MGC51025 antibody (70R-3892)

Rabbit polyclonal MGC51025 antibody raised against the middle region of Mgc51025

Synonyms Polyclonal MGC51025 antibody, Anti-MGC51025 antibody, MGC-51025, MGC-51025 antibody, MGC 51025, MGC 51025 antibody, MGC51025
Specificity MGC51025 antibody was raised against the middle region of Mgc51025
Cross Reactivity Human
Applications WB
Immunogen MGC51025 antibody was raised using the middle region of Mgc51025 corresponding to a region with amino acids RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKH
Assay Information MGC51025 Blocking Peptide, catalog no. 33R-7932, is also available for use as a blocking control in assays to test for specificity of this MGC51025 antibody

Images

Western Blot analysis using MGC51025 antibody (70R-3892)

MGC51025 antibody (70R-3892) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC51025 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MGC51025 may act as a GTPase-activating protein for Rab family proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MGC51025 antibody (70R-3892) | MGC51025 antibody (70R-3892) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors