MGC87631 antibody (70R-4558)

Rabbit polyclonal MGC87631 antibody raised against the middle region of MGC87631

Synonyms Polyclonal MGC87631 antibody, Anti-MGC87631 antibody, MGC-87631, Coiled-Coil Domain Containing 144 Family N-Terminal Like antibody, MGC-87631 antibody, MGC 87631 antibody, MGC87631, MGC 87631
Specificity MGC87631 antibody was raised against the middle region of MGC87631
Cross Reactivity Human
Applications WB
Immunogen MGC87631 antibody was raised using the middle region of MGC87631 corresponding to a region with amino acids VDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVACGTV
Assay Information MGC87631 Blocking Peptide, catalog no. 33R-9467, is also available for use as a blocking control in assays to test for specificity of this MGC87631 antibody

Images

Western Blot analysis using MGC87631 antibody (70R-4558)

MGC87631 antibody (70R-4558) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC87631 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC87631 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MGC87631 antibody (70R-4558) | MGC87631 antibody (70R-4558) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors