MGMT antibody (70R-3376)

Rabbit polyclonal MGMT antibody raised against the middle region of MGMT

Synonyms Polyclonal MGMT antibody, Anti-MGMT antibody, O-6-MethylRNA guanine-Dna Methyltransferase antibody
Specificity MGMT antibody was raised against the middle region of MGMT
Cross Reactivity Human
Applications WB
Immunogen MGMT antibody was raised using the middle region of MGMT corresponding to a region with amino acids ISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGG
Assay Information MGMT Blocking Peptide, catalog no. 33R-4170, is also available for use as a blocking control in assays to test for specificity of this MGMT antibody

Images

Western Blot analysis using MGMT antibody (70R-3376)

MGMT antibody (70R-3376) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGMT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MGMT is involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA.MGMT repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MGMT antibody (70R-3376) | MGMT antibody (70R-3376) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors