MGRN1 antibody (70R-2641)

Rabbit polyclonal MGRN1 antibody raised against the middle region of MGRN1

Synonyms Polyclonal MGRN1 antibody, Anti-MGRN1 antibody, MGRN-1 antibody, MGRN 1, MGRN 1 antibody, MGRN1, Mahogunin Ring Finger 1 antibody, RNF156 antibody, KIAA0544 antibody, MGRN-1
Specificity MGRN1 antibody was raised against the middle region of MGRN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MGRN1 antibody was raised using the middle region of MGRN1 corresponding to a region with amino acids EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTS
Assay Information MGRN1 Blocking Peptide, catalog no. 33R-2492, is also available for use as a blocking control in assays to test for specificity of this MGRN1 antibody


Western Blot analysis using MGRN1 antibody (70R-2641)

MGRN1 antibody (70R-2641) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGRN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MGRN1 antibody (70R-2641) | MGRN1 antibody (70R-2641) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors