MGST2 antibody (70R-1664)

Rabbit polyclonal MGST2 antibody raised against the N terminal of MGST2

Synonyms Polyclonal MGST2 antibody, Anti-MGST2 antibody, GST2 antibody, MGST 2 antibody, MGST-2 antibody, FLJ27438 antibody, Microsomal Glutathione S-Transferase 2 antibody, MGST 2, MGST-II antibody, MGST2, MGC14097 antibody, MGST-2
Specificity MGST2 antibody was raised against the N terminal of MGST2
Cross Reactivity Human
Applications IHC, WB
Immunogen MGST2 antibody was raised using the N terminal of MGST2 corresponding to a region with amino acids MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVF
Assay Information MGST2 Blocking Peptide, catalog no. 33R-5664, is also available for use as a blocking control in assays to test for specificity of this MGST2 antibody


Immunohistochemical staining using MGST2 antibody (70R-1664)

MGST2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MGST2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. MGST2 is a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using MGST2 antibody (70R-1664) | MGST2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using MGST2 antibody (70R-1664) | MGST2 antibody (70R-1664) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using MGST2 antibody (70R-1664) | MGST2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors