MIF4GD antibody (70R-4748)

Rabbit polyclonal MIF4GD antibody raised against the N terminal of MIF4GD

Synonyms Polyclonal MIF4GD antibody, Anti-MIF4GD antibody, MIFGD-4, AD023 antibody, MIFD antibody, SLIP1 antibody, MIFGD 4, MIF4GD, MGC45027 antibody, MIFGD-4 antibody, Mif4G Domain Containing antibody, MIFGD 4 antibody
Specificity MIF4GD antibody was raised against the N terminal of MIF4GD
Cross Reactivity Human
Applications WB
Immunogen MIF4GD antibody was raised using the N terminal of MIF4GD corresponding to a region with amino acids MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSR
Assay Information MIF4GD Blocking Peptide, catalog no. 33R-6024, is also available for use as a blocking control in assays to test for specificity of this MIF4GD antibody

Images

Western Blot analysis using MIF4GD antibody (70R-4748)

MIF4GD antibody (70R-4748) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MIF4GD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MIF4GD is a protein which contains an MIF4G domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MIF4GD antibody (70R-4748) | MIF4GD antibody (70R-4748) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors