MITD1 antibody (70R-4507)

Rabbit polyclonal MITD1 antibody raised against the middle region of MITD1

Synonyms Polyclonal MITD1 antibody, Anti-MITD1 antibody, Mit Microtubule Interacting And Transport Domain Containing 1 antibody, MITD 1 antibody, MITD-1 antibody, MITD 1, MITD1, MITD-1
Specificity MITD1 antibody was raised against the middle region of MITD1
Cross Reactivity Human
Applications WB
Immunogen MITD1 antibody was raised using the middle region of MITD1 corresponding to a region with amino acids SHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDF
Assay Information MITD1 Blocking Peptide, catalog no. 33R-8509, is also available for use as a blocking control in assays to test for specificity of this MITD1 antibody


Western Blot analysis using MITD1 antibody (70R-4507)

MITD1 antibody (70R-4507) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MITD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MITD1 may play a role in endosomal protein transport.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MITD1 antibody (70R-4507) | MITD1 antibody (70R-4507) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors