MKRN1 antibody (70R-1219)

Rabbit polyclonal MKRN1 antibody raised against the C terminal of MKRN1

Synonyms Polyclonal MKRN1 antibody, Anti-MKRN1 antibody, MKRN-1, Makorin Ring Finger Protein 1 antibody, MKRN 1 antibody, MKRN-1 antibody, FLJ21334 antibody, RNF61 antibody, MKRN1, MKRN 1
Specificity MKRN1 antibody was raised against the C terminal of MKRN1
Cross Reactivity Human, Mouse, Dog
Applications WB
Immunogen MKRN1 antibody was raised using the C terminal of MKRN1 corresponding to a region with amino acids RYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW
Assay Information MKRN1 Blocking Peptide, catalog no. 33R-8272, is also available for use as a blocking control in assays to test for specificity of this MKRN1 antibody


Western Blot analysis using MKRN1 antibody (70R-1219)

MKRN1 antibody (70R-1219) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MKRN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The Makorin ring finger protein-1 (MKRN1) is a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MKRN1 antibody (70R-1219) | MKRN1 antibody (70R-1219) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors