MLC1 antibody (70R-5137)

Rabbit polyclonal MLC1 antibody raised against the middle region of MLC1

Synonyms Polyclonal MLC1 antibody, Anti-MLC1 antibody, MLC1, VL antibody, MLC-1 antibody, MLC 1, LVM antibody, MLC-1, Megalencephalic Leukoencephalopathy With Subcortical Cysts 1 antibody, KIAA0027 antibody, MLC antibody, MLC 1 antibody
Specificity MLC1 antibody was raised against the middle region of MLC1
Cross Reactivity Human
Applications WB
Immunogen MLC1 antibody was raised using the middle region of MLC1 corresponding to a region with amino acids SDSANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHL
Assay Information MLC1 Blocking Peptide, catalog no. 33R-8370, is also available for use as a blocking control in assays to test for specificity of this MLC1 antibody

Images

Immunofluorescent staining using MLC1 antibody (70R-5137)

MLC1 antibody used at a dilution of 1:50 to detect rat astrocytes.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MLC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MLC1 may be a transporter. It may act as a non-selective neuronal cation channel.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunofluorescent staining using MLC1 antibody (70R-5137) | MLC1 antibody used at a dilution of 1:50 to detect rat astrocytes.
  • Western Blot analysis using MLC1 antibody (70R-5137) | MLC1 antibody (70R-5137) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors