MLH3 antibody (70R-5576)

Rabbit polyclonal MLH3 antibody

Synonyms Polyclonal MLH3 antibody, Anti-MLH3 antibody, MLH 3, MLH-3, MLH 3 antibody, MGC138372 antibody, MLH3, MLH-3 antibody, HNPCC7 antibody, Mutl Homolog 3 antibody
Cross Reactivity Human
Applications WB
Immunogen MLH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMQVLQQVDNKFIACLMSTKTEENGEADSYEKQQAQGSGRKKLLSSTLIP
Assay Information MLH3 Blocking Peptide, catalog no. 33R-8644, is also available for use as a blocking control in assays to test for specificity of this MLH3 antibody


Western Blot analysis using MLH3 antibody (70R-5576)

MLH3 antibody (70R-5576) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 161 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MLH3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the MutL-homolog (MLH) family of DNA mismatch repair (MMR) genes. MLH genes are implicated in maintaining genomic integrity during DNA replication and after meiotic recombination. MLH3 functions as a heterodimer with other family members. Somatic mutations in this gene frequently occur in tumors exhibiting microsatellite instability, and germline mutations have been linked to hereditary nonpolyposis colorectal cancer type 7 (HNPCC7). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MLH3 antibody (70R-5576) | MLH3 antibody (70R-5576) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors