MLSTD2 antibody (70R-1829)

Rabbit polyclonal MLSTD2 antibody raised against the N terminal Of Mlstd2

Synonyms Polyclonal MLSTD2 antibody, Anti-MLSTD2 antibody, MLSTD 2, FLJ33561 antibody, DKFZp686P18247 antibody, MLSTD-2, FAR1 antibody, FLJ22728 antibody, MLSTD-2 antibody, MLSTD2, MLSTD 2 antibody, DKFZp686A0370 antibody
Specificity MLSTD2 antibody was raised against the N terminal Of Mlstd2
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII
Assay Information MLSTD2 Blocking Peptide, catalog no. 33R-5390, is also available for use as a blocking control in assays to test for specificity of this MLSTD2 antibody


Western Blot analysis using MLSTD2 antibody (70R-1829)

MLSTD2 antibody (70R-1829) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MLSTD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MLSTD2 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MLSTD2 antibody (70R-1829) | MLSTD2 antibody (70R-1829) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors