MMP19 antibody (70R-4600)

Rabbit polyclonal MMP19 antibody raised against the N terminal of MMP19

Synonyms Polyclonal MMP19 antibody, Anti-MMP19 antibody, MMP-19, MMP 19 antibody, MMP-19 antibody, Matrix Metallopeptidase 19 antibody, MMP 19, MMP-19 antibody, MMP19, MMP 19 antibody
Specificity MMP19 antibody was raised against the N terminal of MMP19
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen MMP19 antibody was raised using the N terminal of MMP19 corresponding to a region with amino acids ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR
Assay Information MMP19 Blocking Peptide, catalog no. 33R-1365, is also available for use as a blocking control in assays to test for specificity of this MMP19 antibody


Immunohistochemical staining using MMP19 antibody (70R-4600)

MMP19 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Ganglionic cells (arrows) in Human urinary bladder. Magnification is at 400X.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MMP19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The function of MMP-19 has not been determined. This gene corresponding to this protein was previously referred to as MMP18 but has been renamed matrix metalloproteinase 19 (MMP19). Multiple transcript variants encoding distict isoforms have been identified for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using MMP19 antibody (70R-4600) | MMP19 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Ganglionic cells (arrows) in Human urinary bladder. Magnification is at 400X.
  • Western Blot analysis using MMP19 antibody (70R-4600) | MMP19 antibody (70R-4600) used at 0.5 ug/ml to detect target protein.
  • Immunohistochemical staining using MMP19 antibody (70R-4600) | MMP19 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells (arrows) in Human Urinary bladder. Magnification is at 400X

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors