MMP7 antibody (70R-1557)

Rabbit polyclonal MMP7 antibody

Synonyms Polyclonal MMP7 antibody, Anti-MMP7 antibody, Matrix Metallopeptidase 7 antibody, MMP-7, MMP-7 antibody, Matrilysin Uterine antibody, PUMP-1 antibody, MMP 7 antibody, MMP-7 antibody, MMP7, MMP 7, MPSL1 antibody
Cross Reactivity Human
Applications WB
Immunogen MMP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK
Assay Information MMP7 Blocking Peptide, catalog no. 33R-1053, is also available for use as a blocking control in assays to test for specificity of this MMP7 antibody

Images

Western Blot analysis using MMP7 antibody (70R-1557)

MMP7 antibody (70R-1557) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MMP7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP7 degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MMP7 antibody (70R-1557) | MMP7 antibody (70R-1557) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors