MORC3 antibody (70R-2138)

Rabbit polyclonal MORC3 antibody raised against the N terminal of MORC3

Synonyms Polyclonal MORC3 antibody, Anti-MORC3 antibody, MORC 3 antibody, ZCWCC3 antibody, MORC3, Morc Family Cw-Type Zinc Finger 3 antibody, MORC-3 antibody, ZCW5 antibody, MORC-3, NXP2 antibody, MORC 3
Specificity MORC3 antibody was raised against the N terminal of MORC3
Cross Reactivity Human,Mouse
Applications WB
Immunogen MORC3 antibody was raised using the N terminal of MORC3 corresponding to a region with amino acids KLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEIT
Assay Information MORC3 Blocking Peptide, catalog no. 33R-4516, is also available for use as a blocking control in assays to test for specificity of this MORC3 antibody


Western Blot analysis using MORC3 antibody (70R-2138)

MORC3 antibody (70R-2138) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 107 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MORC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MORC3 localizes to the nuclear matrix. Also, MORC3 has RNA binding activity, and has a predicted coiled-coil domain. The protein also has RNA binding activity, and has a predicted coiled-coil domain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MORC3 antibody (70R-2138) | MORC3 antibody (70R-2138) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors