MOV10 antibody (70R-1306)

Rabbit polyclonal MOV10 antibody

Synonyms Polyclonal MOV10 antibody, Anti-MOV10 antibody, MOV 10 antibody, KIAA1631 antibody, MOV 10, Mov10 Moloney Leukemia Virus 10 Homolog antibody, gb110 antibody, MOV10, MOV-10 antibody, MOV-10, RP11-426L16.2 antibody, FLJ32791 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR
Assay Information MOV10 Blocking Peptide, catalog no. 33R-1300, is also available for use as a blocking control in assays to test for specificity of this MOV10 antibody

Images

Western Blot analysis using MOV10 antibody (70R-1306)

MOV10 antibody (70R-1306) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 110 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MOV10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MOV10 may be an helicase with an important function in development and/or control of cell proliferation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MOV10 antibody (70R-1306) | MOV10 antibody (70R-1306) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors