MOV10L1 antibody (70R-4743)

Rabbit polyclonal MOV10L1 antibody

Synonyms Polyclonal MOV10L1 antibody, Anti-MOV10L1 antibody, FLJ33421 antibody, MOV 10 antibody, MOV-10 antibody, DJ402G11.8 antibody, Mov10L1 Moloney Leukemia Virus 10-Like 1 Homolog antibody, MOV10, DKFZp434B0717 antibody, MOV 10, MOV-10
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MOV10L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL
Assay Information MOV10L1 Blocking Peptide, catalog no. 33R-5253, is also available for use as a blocking control in assays to test for specificity of this MOV10L1 antibody

Images

Western Blot analysis using MOV10L1 antibody (70R-4743)

MOV10L1 antibody (70R-4743) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 135 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MOV10L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is similar to a mouse gene that encodes a putative RNA helicase and shows testis-specific expression. Multiple transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MOV10L1 antibody (70R-4743) | MOV10L1 antibody (70R-4743) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors