MPP5 antibody (70R-2478)

Rabbit polyclonal MPP5 antibody

Synonyms Polyclonal MPP5 antibody, Anti-MPP5 antibody, FLJ12615 antibody, Maguk P55 Subfamily Member 5 antibody, MPP-5 antibody, PALS1 antibody, MPP 5 antibody, MPP 5, MPP-5, MPP5, Membrane Protein Palmitoylated 5 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM
Assay Information MPP5 Blocking Peptide, catalog no. 33R-1585, is also available for use as a blocking control in assays to test for specificity of this MPP5 antibody

Images

Western Blot analysis using MPP5 antibody (70R-2478)

MPP5 antibody (70R-2478) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MPP5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like, ZO1-like, p55-like, and LIN2-like, based on their size and the presence of additional domains. MPP5 is a member of the p55-like MAGUK subfamily.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MPP5 antibody (70R-2478) | MPP5 antibody (70R-2478) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors