MPP7 antibody (70R-2195)

Rabbit polyclonal MPP7 antibody

Synonyms Polyclonal MPP7 antibody, Anti-MPP7 antibody, MPP-7 antibody, MPP7, Membrane Protein Palmitoylated 7 antibody, MPP 7 antibody, Maguk P55 Subfamily Member 7 antibody, FLJ32798 antibody, MPP-7, MPP 7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MPP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL
Assay Information MPP7 Blocking Peptide, catalog no. 33R-6270, is also available for use as a blocking control in assays to test for specificity of this MPP7 antibody


Western Blot analysis using MPP7 antibody (70R-2195)

MPP7 antibody (70R-2195) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MPP7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MPP7 acts as an important adapter that promotes epithelial cell polarity and tight junction formation via its interaction with DLG1. MPP7 is involved in the assembly of protein complexes at sites of cell-cell contact.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MPP7 antibody (70R-2195) | MPP7 antibody (70R-2195) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors