MPPED2 antibody (70R-5251)

Rabbit polyclonal MPPED2 antibody raised against the N terminal of MPPED2

Synonyms Polyclonal MPPED2 antibody, Anti-MPPED2 antibody, C11orf8 antibody, dJ1024C24.1 antibody, Metallophosphoesterase Domain Containing 2 antibody, Hs.46638 antibody, MPPED2, D11S302E antibody, dJ873F21.1 antibody, MPPED 2, 239FB antibody, MPPED-2 antibody, FAM1B antibody, MPPED-2, MPPED 2 antibody
Specificity MPPED2 antibody was raised against the N terminal of MPPED2
Cross Reactivity Human,Rat
Applications WB
Immunogen MPPED2 antibody was raised using the N terminal of MPPED2 corresponding to a region with amino acids RFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHT
Assay Information MPPED2 Blocking Peptide, catalog no. 33R-7906, is also available for use as a blocking control in assays to test for specificity of this MPPED2 antibody

Images

Western Blot analysis using MPPED2 antibody (70R-5251)

MPPED2 antibody (70R-5251) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MPPED2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of MPPED2 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MPPED2 antibody (70R-5251) | MPPED2 antibody (70R-5251) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors