MRPL10 antibody (70R-2443)

Rabbit polyclonal MRPL10 antibody raised against the N terminal of MRPL10

Synonyms Polyclonal MRPL10 antibody, Anti-MRPL10 antibody, MRPL 10 antibody, Mitochondrial Ribosomal Protein L10 antibody, MRPL 10, MRPL-10, MRPL-10 antibody, MRPL10, MRP-L8 antibody, MGC17973 antibody, RPML8 antibody
Specificity MRPL10 antibody was raised against the N terminal of MRPL10
Cross Reactivity Human
Applications WB
Immunogen MRPL10 antibody was raised using the N terminal of MRPL10 corresponding to a region with amino acids HRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRRE
Assay Information MRPL10 Blocking Peptide, catalog no. 33R-3847, is also available for use as a blocking control in assays to test for specificity of this MRPL10 antibody


Western Blot analysis using MRPL10 antibody (70R-2443)

MRPL10 antibody (70R-2443) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MRPL10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 5q.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MRPL10 antibody (70R-2443) | MRPL10 antibody (70R-2443) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors