MSH5 antibody (70R-5575)

Rabbit polyclonal MSH5 antibody

Synonyms Polyclonal MSH5 antibody, Anti-MSH5 antibody, MutSH5 antibody, MSH5, G7 antibody, MGC2939 antibody, MSH-5, DKFZp434C1615 antibody, MSH 5 antibody, NG23 antibody, MSH-5 antibody, MSH 5, Muts Homolog 5 antibody
Cross Reactivity Human
Applications WB
Immunogen MSH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTPPGDLRFTPIPLLI
Assay Information MSH5 Blocking Peptide, catalog no. 33R-4613, is also available for use as a blocking control in assays to test for specificity of this MSH5 antibody

Images

Western Blot analysis using MSH5 antibody (70R-5575)

MSH5 antibody (70R-5575) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 95 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MSH5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MSH5 is a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MSH5 antibody (70R-5575) | MSH5 antibody (70R-5575) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors