MSH5 antibody (70R-5579)

Rabbit polyclonal MSH5 antibody

Synonyms Polyclonal MSH5 antibody, Anti-MSH5 antibody, G7 antibody, Muts Homolog 5 antibody, MSH 5, MSH-5, MSH5, MSH-5 antibody, MSH 5 antibody, DKFZp434C1615 antibody, MutSH5 antibody, NG23 antibody, MGC2939 antibody
Cross Reactivity Human,Rat
Applications WB
Immunogen MSH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DENMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIP
Assay Information MSH5 Blocking Peptide, catalog no. 33R-1915, is also available for use as a blocking control in assays to test for specificity of this MSH5 antibody


Western Blot analysis using MSH5 antibody (70R-5579)

MSH5 antibody (70R-5579) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 93 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MSH5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MSH5 is a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MSH5 antibody (70R-5579) | MSH5 antibody (70R-5579) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors