MSL2L1 antibody (70R-2100)

Rabbit polyclonal MSL2L1 antibody

Synonyms Polyclonal MSL2L1 antibody, Anti-MSL2L1 antibody, KIAA1585 antibody, MSLL1 2 antibody, MSLL1-2, MSL2L1, MSLL1 2, MSLL1-2 antibody, FLJ10546 antibody, MSL-2 antibody, RNF184 antibody, Male-Specific Lethal 2-Like 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MSL2L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL
Assay Information MSL2L1 Blocking Peptide, catalog no. 33R-6835, is also available for use as a blocking control in assays to test for specificity of this MSL2L1 antibody


Western Blot analysis using MSL2L1 antibody (70R-2100)

MSL2L1 antibody (70R-2100) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MSL2L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MSL2L1 is the component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at lysine 16 which is implicated in the formation of higher-order chromatin structure.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MSL2L1 antibody (70R-2100) | MSL2L1 antibody (70R-2100) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors