MTHFD2 antibody (70R-2438)

Rabbit polyclonal MTHFD2 antibody

Synonyms Polyclonal MTHFD2 antibody, Anti-MTHFD2 antibody, MTHFD-2 antibody, NMDMC antibody, Methylenetetrahydrofolate Dehydrogenase antibody, MTHFD 2, Nadp+ Dependent 2 Methenyltetrahydrofolate Cyclohydrolase antibody, MTHFD-2, MTHFD 2 antibody, MTHFD2
Cross Reactivity Human
Applications WB
Immunogen MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLN
Assay Information MTHFD2 Blocking Peptide, catalog no. 33R-9604, is also available for use as a blocking control in assays to test for specificity of this MTHFD2 antibody


Western Blot analysis using MTHFD2 antibody (70R-2438)

MTHFD2 antibody (70R-2438) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTHFD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MTHFD2 antibody (70R-2438) | MTHFD2 antibody (70R-2438) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors