MTHFD2L antibody (70R-3409)

Rabbit polyclonal MTHFD2L antibody

Synonyms Polyclonal MTHFD2L antibody, Anti-MTHFD2L antibody, MTHFD2L, Methylenetetrahydrofolate Dehydrogenase antibody, FLJ13105 antibody, MTHFDL-2, MTHFDL 2 antibody, MTHFDL 2, Nadp+ Dependent 2-Like antibody, MGC72244 antibody, MTHFDL-2 antibody, MGC45532 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MTHFD2L antibody was raised using a synthetic peptide corresponding to a region with amino acids TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTP
Assay Information MTHFD2L Blocking Peptide, catalog no. 33R-9087, is also available for use as a blocking control in assays to test for specificity of this MTHFD2L antibody

Images

Western Blot analysis using MTHFD2L antibody (70R-3409)

MTHFD2L antibody (70R-3409) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTHFD2L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MTHFD2L protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MTHFD2L antibody (70R-3409) | MTHFD2L antibody (70R-3409) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors