MTHFSD antibody (70R-1453)

Rabbit polyclonal MTHFSD antibody raised against the N terminal of MTHFSD

Synonyms Polyclonal MTHFSD antibody, Anti-MTHFSD antibody, Methenyltetrahydrofolate Synthetase Domain Containing antibody
Specificity MTHFSD antibody was raised against the N terminal of MTHFSD
Cross Reactivity Human,Mouse,Dog
Applications IHC, WB
Immunogen MTHFSD antibody was raised using the N terminal of MTHFSD corresponding to a region with amino acids EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL
Assay Information MTHFSD Blocking Peptide, catalog no. 33R-2798, is also available for use as a blocking control in assays to test for specificity of this MTHFSD antibody

Images

Immunohistochemical staining using MTHFSD antibody (70R-1453)

MTHFSD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MTHFSD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.625 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function remains unknows.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using MTHFSD antibody (70R-1453) | MTHFSD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using MTHFSD antibody (70R-1453) | MTHFSD antibody (70R-1453) used at 0.625 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors