MTIF3 antibody (70R-2640)

Rabbit polyclonal MTIF3 antibody raised against the middle region of MTIF3

Synonyms Polyclonal MTIF3 antibody, Anti-MTIF3 antibody, MTIF3, IF-3mt antibody, MTIF-3, MTIF 3 antibody, MTIF 3, MTIF-3 antibody, Mitochondrial Translational Initiation Factor 3 antibody, IF3(mt) antibody
Specificity MTIF3 antibody was raised against the middle region of MTIF3
Cross Reactivity Human
Applications WB
Immunogen MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
Assay Information MTIF3 Blocking Peptide, catalog no. 33R-1612, is also available for use as a blocking control in assays to test for specificity of this MTIF3 antibody


Western Blot analysis using MTIF3 antibody (70R-2640)

MTIF3 antibody (70R-2640) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTIF3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MTIF3 antibody (70R-2640) | MTIF3 antibody (70R-2640) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors