MTMR12 antibody (70R-2660)

Rabbit polyclonal MTMR12 antibody raised against the middle region of MTMR12

Synonyms Polyclonal MTMR12 antibody, Anti-MTMR12 antibody, 3-PAP antibody, MTMR12, MTMR-12 antibody, MTMR 12 antibody, MTMR-12, PIP3AP antibody, Myotubularin Related Protein 12 antibody, MTMR 12
Specificity MTMR12 antibody was raised against the middle region of MTMR12
Cross Reactivity Human,Mouse
Applications WB
Immunogen MTMR12 antibody was raised using the middle region of MTMR12 corresponding to a region with amino acids RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGD
Assay Information MTMR12 Blocking Peptide, catalog no. 33R-8086, is also available for use as a blocking control in assays to test for specificity of this MTMR12 antibody

Images

Western Blot analysis using MTMR12 antibody (70R-2660)

MTMR12 antibody (70R-2660) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTMR12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTMR12 inactives phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.Phosphatidylinositide 3-kinase-derived membrane-anchored phosphatidylinositides, such as phosphatidylinositol 3-phosphate (PtdIns(3)P), regulate diverse cellular processes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MTMR12 antibody (70R-2660) | MTMR12 antibody (70R-2660) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors