MTR antibody (70R-5231)

Rabbit polyclonal MTR antibody raised against the C terminal of MTR

Synonyms Polyclonal MTR antibody, Anti-MTR antibody, FLJ45386 antibody, 5-Methyltetrahydrofolate-Homocysteine Methyltransferase antibody
Specificity MTR antibody was raised against the C terminal of MTR
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MTR antibody was raised using the C terminal of MTR corresponding to a region with amino acids GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL
Assay Information MTR Blocking Peptide, catalog no. 33R-3557, is also available for use as a blocking control in assays to test for specificity of this MTR antibody

Images

Western Blot analysis using MTR antibody (70R-5231)

MTR antibody (70R-5231) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 140 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTR is the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MTR antibody (70R-5231) | MTR antibody (70R-5231) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors