MTRR antibody (70R-4020)

Rabbit polyclonal MTRR antibody raised against the N terminal of MTRR

Synonyms Polyclonal MTRR antibody, Anti-MTRR antibody, 5-Methyltetrahydrofolate-Homocysteine Methyltransferase Reductase antibody, MGC129643 antibody, MSR antibody
Specificity MTRR antibody was raised against the N terminal of MTRR
Cross Reactivity Human
Applications WB
Immunogen MTRR antibody was raised using the N terminal of MTRR corresponding to a region with amino acids YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL
Assay Information MTRR Blocking Peptide, catalog no. 33R-10071, is also available for use as a blocking control in assays to test for specificity of this MTRR antibody

Images

Western Blot analysis using MTRR antibody (70R-4020)

MTRR antibody (70R-4020) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTRR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MTRR antibody (70R-4020) | MTRR antibody (70R-4020) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors