MUC1 antibody (70R-1744)

Rabbit polyclonal MUC1 antibody raised against the C terminal of MUC1

Synonyms Polyclonal MUC1 antibody, Anti-MUC1 antibody, Mucin 1 Cell Surface Associated antibody, MUC 1 antibody, PUM antibody, EMA antibody, MUC 1, MUC1, MUC-1 antibody, PEM antibody, CD227 antibody, MUC-1, mucin antibody
Specificity MUC1 antibody was raised against the C terminal of MUC1
Cross Reactivity Human
Applications IHC, WB
Immunogen MUC1 antibody was raised using the C terminal of MUC1 corresponding to a region with amino acids RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGN
Assay Information MUC1 Blocking Peptide, catalog no. 33R-8143, is also available for use as a blocking control in assays to test for specificity of this MUC1 antibody

Images

Western Blot analysis using MUC1 antibody (70R-1744)

MUC1 antibody (70R-1744) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MUC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MUC1 antibody (70R-1744) | MUC1 antibody (70R-1744) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors