MYL9 antibody (70R-3669)

Rabbit polyclonal MYL9 antibody raised against the middle region of MYL9

Synonyms Polyclonal MYL9 antibody, Anti-MYL9 antibody, Myosin Light Chain 9 Regulatory antibody, MYL-9 antibody, MGC3505 antibody, MYL-9, MYL 9, MYL9, MLC2 antibody, MRLC1 antibody, LC20 antibody, MYL 9 antibody, MYRL2 antibody
Specificity MYL9 antibody was raised against the middle region of MYL9
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MYL9 antibody was raised using the middle region of MYL9 corresponding to a region with amino acids FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF
Assay Information MYL9 Blocking Peptide, catalog no. 33R-2863, is also available for use as a blocking control in assays to test for specificity of this MYL9 antibody

Images

Western blot analysis using MYL9 antibody (70R-3669)

Recommended MYL9 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYL9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Myosin, a structural component of muscle, consists of two heavy chains and four light chains. MYL9 is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. It binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. Myosin, a structural component of muscle, consists of two heavy chains and four light chains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using MYL9 antibody (70R-3669) | Recommended MYL9 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors