Myosin Ic antibody (70R-2182)

Rabbit polyclonal Myosin Ic antibody raised against the N terminal of MYO1C

Synonyms Polyclonal Myosin Ic antibody, Anti-Myosin Ic antibody, MMIb antibody, MMI-beta antibody, myr2 antibody, NMI antibody, MYO1C antibody, FLJ23903 antibody
Specificity Myosin Ic antibody was raised against the N terminal of MYO1C
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Myosin Ic antibody was raised using the N terminal of MYO1C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV
Assay Information Myosin Ic Blocking Peptide, catalog no. 33R-6834, is also available for use as a blocking control in assays to test for specificity of this Myosin Ic antibody


Western Blot analysis using Myosin Ic antibody (70R-2182)

Myosin Ic antibody (70R-2182) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 113 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYO1C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Myosin Ic antibody (70R-2182) | Myosin Ic antibody (70R-2182) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors