Myozenin 1 antibody (70R-2197)

Rabbit polyclonal Myozenin 1 antibody raised against the middle region of MYOZ1

Synonyms Polyclonal Myozenin 1 antibody, Anti-Myozenin 1 antibody, Myozenin -1 antibody, FATZ antibody, CS-2 antibody, Myozenin 1, Myozenin 1, MYOZ antibody, Myozenin 1 antibody, MYOZ1 antibody, Myozenin -1
Specificity Myozenin 1 antibody was raised against the middle region of MYOZ1
Cross Reactivity Human
Applications WB
Immunogen Myozenin 1 antibody was raised using the middle region of MYOZ1 corresponding to a region with amino acids TVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPY
Assay Information Myozenin 1 Blocking Peptide, catalog no. 33R-9352, is also available for use as a blocking control in assays to test for specificity of this Myozenin 1 antibody

Images

Western Blot analysis using Myozenin 1 antibody (70R-2197)

Myozenin 1 antibody (70R-2197) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYOZ1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Myozenin 1 antibody (70R-2197) | Myozenin 1 antibody (70R-2197) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors