NANP antibody (70R-4175)

Rabbit polyclonal NANP antibody raised against the middle region of NANP

Synonyms Polyclonal NANP antibody, Anti-NANP antibody, MGC26833 antibody, N-Acetylneuraminic Acid Phosphatase antibody, C20orf147 antibody, dJ694B14.3 antibody, HDHD4 antibody
Specificity NANP antibody was raised against the middle region of NANP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NANP antibody was raised using the middle region of NANP corresponding to a region with amino acids VQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVS
Assay Information NANP Blocking Peptide, catalog no. 33R-9755, is also available for use as a blocking control in assays to test for specificity of this NANP antibody

Images

Western Blot analysis using NANP antibody (70R-4175)

NANP antibody (70R-4175) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NANP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of NANP protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NANP antibody (70R-4175) | NANP antibody (70R-4175) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors