NAP1L2 antibody (70R-4524)

Rabbit polyclonal NAP1L2 antibody raised against the middle region of NAP1L2

Synonyms Polyclonal NAP1L2 antibody, Anti-NAP1L2 antibody, NAPL2 1 antibody, BPX antibody, NAPL2 1, NAP1L2, Nucleosome Assembly Protein 1-Like 2 antibody, NAPL2-1, MGC26243 antibody, NAPL2-1 antibody
Specificity NAP1L2 antibody was raised against the middle region of NAP1L2
Cross Reactivity Human
Applications WB
Immunogen NAP1L2 antibody was raised using the middle region of NAP1L2 corresponding to a region with amino acids VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE
Assay Information NAP1L2 Blocking Peptide, catalog no. 33R-9481, is also available for use as a blocking control in assays to test for specificity of this NAP1L2 antibody

Images

Western Blot analysis using NAP1L2 antibody (70R-4524)

NAP1L2 antibody (70R-4524) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NAP1L2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the nucleosome assembly protein (NAP) family. The function of this family member is unknown; however, mouse studies suggest that it represents a class of tissue-specific factors interacting with chromatin to regulate neuronal cell proliferation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NAP1L2 antibody (70R-4524) | NAP1L2 antibody (70R-4524) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors