NARF antibody (70R-2294)

Rabbit polyclonal NARF antibody raised against the middle region of NARF

Synonyms Polyclonal NARF antibody, Anti-NARF antibody, FLJ10067 antibody, IOP2 antibody, DKFZp434G0420 antibody, Nuclear Prelamin A Recognition Factor antibody
Specificity NARF antibody was raised against the middle region of NARF
Cross Reactivity Human
Applications WB
Immunogen NARF antibody was raised using the middle region of NARF corresponding to a region with amino acids FRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLR
Assay Information NARF Blocking Peptide, catalog no. 33R-3054, is also available for use as a blocking control in assays to test for specificity of this NARF antibody


Western Blot analysis using NARF antibody (70R-2294)

NARF antibody (70R-2294) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NARF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NARF binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. NARF is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NARF antibody (70R-2294) | NARF antibody (70R-2294) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors