NARG1L antibody (70R-2233)

Rabbit polyclonal NARG1L antibody raised against the middle region of NARG1L

Synonyms Polyclonal NARG1L antibody, Anti-NARG1L antibody, NARGL-1 antibody, MGC40612 antibody, NARG1L, NARGL 1, RP11-396A22.1 antibody, NARGL 1 antibody, Nmda Receptor Regulated 1-Like antibody, NARGL-1
Specificity NARG1L antibody was raised against the middle region of NARG1L
Cross Reactivity Human, Mouse, Rat
Applications IHC, WB
Immunogen NARG1L antibody was raised using the middle region of NARG1L corresponding to a region with amino acids ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA
Assay Information NARG1L Blocking Peptide, catalog no. 33R-1516, is also available for use as a blocking control in assays to test for specificity of this NARG1L antibody


Immunohistochemical staining using NARG1L antibody (70R-2233)

NARG1L antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NARG1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using NARG1L antibody (70R-2233) | NARG1L antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using NARG1L antibody (70R-2233) | NARG1L antibody (70R-2233) used at 0.5 ug/ml to detect target protein.
  • Immunohistochemical staining using NARG1L antibody (70R-2233) | NARG1L antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors