NAT13 antibody (70R-1206)

Rabbit polyclonal NAT13 antibody raised against the C terminal of NAT13

Synonyms Polyclonal NAT13 antibody, Anti-NAT13 antibody, NAT-13, SAN antibody, hSAN antibody, NAT 13 antibody, hNAT5 antibody, N-Acetyltransferase 13 antibody, NAT13, FLJ13194 antibody, NAT5 antibody, MAK3 antibody, NAT-13 antibody, NAT 13
Specificity NAT13 antibody was raised against the C terminal of NAT13
Cross Reactivity Human
Applications WB
Immunogen NAT13 antibody was raised using the C terminal of NAT13 corresponding to a region with amino acids AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
Assay Information NAT13 Blocking Peptide, catalog no. 33R-1262, is also available for use as a blocking control in assays to test for specificity of this NAT13 antibody


Western Blot analysis using NAT13 antibody (70R-1206)

NAT13 antibody (70R-1206) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NAT13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NAT13 is a probable catalytic component of the ARD1A-NARG1 complex which displays alpha (N-terminal) acetyltransferase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NAT13 antibody (70R-1206) | NAT13 antibody (70R-1206) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors